SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002140 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002140
Domain Number 1 Region: 311-551
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.85e-67
Family Nuclear receptor ligand-binding domain 0.0000000327
Further Details:      
 
Domain Number 2 Region: 178-257
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.75e-26
Family Nuclear receptor 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002140   Gene: ENSONIG00000001710   Transcript: ENSONIT00000002140
Sequence length 667
Comment pep:known_by_projection scaffold:Orenil1.0:GL831232.1:519072:548925:1 gene:ENSONIG00000001710 transcript:ENSONIT00000002140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSPALDADPLPLLQLEEVDSSKATERVSSPGLLPAMYSPPVGIDSHTVCIPSPYTDSN
HDYNHGHGPLTFYSPSMLSYTRPPITDSPSSLCPPLSPSAFWPSHTHHSVPSLTLHCTQP
LVYNEPSPHAPWLDPKVHSISPGSSIITCNKLLGKKSEDGAEGVKSSSCSSALGKADMHF
CAVCHDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRK
CYEVGMMKCGVRRERCGFRGARHRRGGPQPRDTTGQSLVRVGLGSRGQRHLHLGTPLSTL
TPVPHTNHTHHSTMSPKEFISRIMEAEPPEIYLMEDLKKPFTEASMMMTLTNLADKELVL
MISWAKKIPGFVELSLTDQIHLLKCCWLEILMLGLMWRSVDHPGKLIFSPDFKLNREEGQ
CVEGIMEIFDMLLAATSRFRELKLQREEYVCLKAMILLNSNLCTSSPQTPEELESRNKLL
RLLDSVIDALVWAISKLGLSTQQQTLRLGHLTMLLSHIRHVSNKGMDHLSTMKRKNVVLV
YDLLLEMLDANIASSSSQTSSSSPGSDTSSEQQQFPPPPSHLQPGPDQTATAADNTTVPP
VEVPVLDRHLHTFQSTSPSQNLAGSHLDSNDYISAEHWSLNNGDAGPGPSAEPTTYVIPD
RVVTETA
Download sequence
Identical sequences I3IZV0
XP_005455975.1.78416 XP_013130419.1.78416 ENSONIP00000002140 ENSONIP00000002140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]