SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002225 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002225
Domain Number 1 Region: 192-452
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.62e-70
Family Nuclear receptor ligand-binding domain 0.0000000583
Further Details:      
 
Domain Number 2 Region: 118-203
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.78e-31
Family Nuclear receptor 0.00000827
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002225   Gene: ENSONIG00000001778   Transcript: ENSONIT00000002225
Sequence length 454
Comment pep:known_by_projection scaffold:Orenil1.0:GL831223.1:614557:619326:-1 gene:ENSONIG00000001778 transcript:ENSONIT00000002225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LENISLTLISFSFLISFQVSILYIMSSRERRSDVYIKAEPSSPEGGGGGRTSPGGASSDS
SQSGGGATRGDNVKRYSPPLYTPALRCHFKDEGGDGAEEGSAGNGAGRCKYALSTLPKRL
CLVCGDVASGYHYGVASCEACKAFFKRTIQGNIEYSCPASNECEITKRRRKACQACRFTK
CLKVGMLKEGVRLDRVRGGRQKYKRRPEVENATYQSAPLPLTKESEKNSSNIIVSHLLVA
EPEKLFAMPDPLQPDTAQRTLTTLCDLADRELVVIIGWAKHIPGFLSLSLADQMSVLQSV
WLEVLVLGVAYRSLGCEDEVVFAEDFVLDEEMSRAAGLTELNAAISQLARRFRALNVDRE
EFVMLKAIALTNSDSVYIEDMEAVQKLRDLLHQALLEMECQRRPDDPQRAGRLLLTLPLL
RQTAGRALTTFYSIKTRGGVPMHKLFLEMLEAMM
Download sequence
Identical sequences I3J035
ENSONIP00000002225 ENSONIP00000002225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]