SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003748 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003748
Domain Number 1 Region: 104-333,381-428
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.49e-47
Family LacY-like proton/sugar symporter 0.025
Further Details:      
 
Domain Number 2 Region: 547-690
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0000000000000549
Family Glycerol-3-phosphate transporter 0.034
Further Details:      
 
Domain Number 3 Region: 452-531
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000000811
Family Pentapeptide repeats 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003748   Gene: ENSONIG00000002992   Transcript: ENSONIT00000003749
Sequence length 696
Comment pep:known_by_projection scaffold:Orenil1.0:GL831133.1:5930244:5947681:-1 gene:ENSONIG00000002992 transcript:ENSONIT00000003749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDPYHNNVNQQMTEGGDYTYTQDGGGQDGYPYQTDYPPQDEDAASDATEGADEDDQMYE
GEYQGIPHPDEIKEARRAARVEARRKARMAAQQEEEEESLPEQYETIMEDCGHGRFQWML
FFVLGLALMADGVDGFVVGFVLPSAEKDMCISNADKGLLGLLVYVAMMVGALVWGGLCDK
MGRRKCLIYVLTIDLVFSFLSCFAQGYGFFLFLRFCSGFGIGGSIPIVYTYFTEFLQMDK
RGEHLSWLCMFWMFGGLYASFTAWGIIPHYGWGFAIGTQLQMHSWRLFILVCLFPALAAL
IGLVFMPESPRFLLETARHDEAWMILRQVHDTNWKAKGEPERVFTVTNIKTPQTQEDEFI
EIQSETGTAFQRWTVRKMTMLQQVMANVMSLSAPELRLQGLLLVIVWFCLAFSYHGLGVW
FPDMIKYMQYEEYESKVRIFHRERVERFHFNFSLVNQIHREGEYIHDKFANIEIKSVKFE
SSLFENCYFEDIKSTNTFFENCTIKNTVFYNTDLWQEKFKNCRMENATFLHPKKGCHLNF
QEENDIVIYMVSFLGSLAVLPGNIISALFMDKIGRIRIIGGSMLASSACTFLLLLSFSQG
AVICWQCLFYGISVAAWNGLEVISVELYPSSKRLCRGTAFGILNGICKFAAIIASSIFAA
FIGITKIIPIFLAFAALVCGGMVALKLPETREKILS
Download sequence
Identical sequences I3J4F8
ENSONIP00000003748 ENSONIP00000003748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]