SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003842 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003842
Domain Number 1 Region: 164-418
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-67
Family Nuclear receptor ligand-binding domain 0.00000728
Further Details:      
 
Domain Number 2 Region: 96-176
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.55e-30
Family Nuclear receptor 0.0000823
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003842   Gene: ENSONIG00000003070   Transcript: ENSONIT00000003843
Sequence length 432
Comment pep:novel scaffold:Orenil1.0:GL831133.1:6880259:6887182:1 gene:ENSONIG00000003070 transcript:ENSONIT00000003843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVAWRNTEAVGDSQGTLSSPVSQVAPLSLPGELTGHMNPAPSLEIPQTAAAPQGAPPP
NPSGNTVATTTNNNNSTSSSSSSSSLSMDKQQSQQIECIVCGDKSSGKHYGQFTCEGCKS
FFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRIPTQSYHG
QFALTNGDPLQCHSYLSGYISLLLRAEPYPTSRFGSQCLQNNNILGIENICELAARMLFS
AVEWARNIPFFPDLQVPDQVALLRLTWSELFVLNAAQCSMPVHAAPLLAAAGLHASPMSA
DRVVAFMDHIRVFQEQVEKLKVLHVDSAEYSCIKAIVLFTTDACGLSDVAHVEGLQEKSQ
CALEEYVRSQYPNQPNRFGKLLLRLPSLRSVSSSVIEQLFFVRLVGKTPIETLIRDMLLS
GSSFNWPYMPIQ
Download sequence
Identical sequences I3J4Q2
ENSONIP00000003842 XP_005447770.1.78416 ENSONIP00000003842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]