SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003843 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003843
Domain Number 1 Region: 143-397
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.25e-67
Family Nuclear receptor ligand-binding domain 0.00000728
Further Details:      
 
Domain Number 2 Region: 75-155
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-30
Family Nuclear receptor 0.0000823
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003843   Gene: ENSONIG00000003070   Transcript: ENSONIT00000003844
Sequence length 411
Comment pep:novel scaffold:Orenil1.0:GL831133.1:6881030:6885588:1 gene:ENSONIG00000003070 transcript:ENSONIT00000003844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVAWRNTEAVGDSQGTLSSPVSQVAPLSLPGEGAPPPNPSGNTVATTTNNNNSTSSSS
SSSSLSMDKQQSQQIECIVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCP
IDQHHRNQCQYCRLKKCLKVGMRREAVQRGRIPTQSYHGQFALTNGDPLQCHSYLSGYIS
LLLRAEPYPTSRFGSQCLQNNNILGIENICELAARMLFSAVEWARNIPFFPDLQVPDQVA
LLRLTWSELFVLNAAQCSMPVHAAPLLAAAGLHASPMSADRVVAFMDHIRVFQEQVEKLK
VLHVDSAEYSCIKAIVLFTTDACGLSDVAHVEGLQEKSQCALEEYVRSQYPNQPNRFGKL
LLRLPSLRSVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMPIQ
Download sequence
Identical sequences I3J4Q3
ENSONIP00000003843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]