SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004092 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004092
Domain Number 1 Region: 526-716
Classification Level Classification E-value
Superfamily Sec7 domain 1.44e-66
Family Sec7 domain 0.00000435
Further Details:      
 
Domain Number 2 Region: 748-872
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000615
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004092   Gene: ENSONIG00000003259   Transcript: ENSONIT00000004093
Sequence length 1136
Comment pep:known_by_projection scaffold:Orenil1.0:GL831180.1:3172778:3247121:1 gene:ENSONIG00000003259 transcript:ENSONIT00000004093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKFKAFCLDYWQFLCLQPLHGFYKSVEGDAPGTEVGASLDPSGGYSCVPVTHSGGLGPD
HLDSQLYGHILLPGHSRPRRPKLQHSQSILRKQAEEEAIKRSRSLSESYELSSDLQDKQV
EMLERKYGGRFITRHAARTIQTAFRQYQMNKNFERLRSSMSENRMSRRIVLSNMRMQFSF
EGPEKVHSSYFEGKQVSLTDDGTKIGALRQSDHGGEMGVQAKTPTTQSDFTDAITELEDA
FSRQVKSLAESIDDALNCRSLHGEDSQSEPGRGLQDMDREVTCQVKPSHSASEHRKLDEM
TASYSDVTLYIDEEELSPPLPLSQSVDRPSSTESDLRQRSLNSSQDYWSLAHKDEKGDTD
TSCRSTPSLECQEQRLRVDHLPLLTIEPPSDSSVELSDRSDRSSLKRQNAYERSISNQQS
SPKQVSHSLPPRGPSREEDTSRHRSRQLEAHLAINGTANRQSKSESDFSDGDNDSINSTS
NSNDTINCSSESSSRDSLREQTLSKQTYHKETRNSWDSPAFSNDIIRKRHYRIGLNLFNK
KPEKGIQYLIERNFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEM
DFSAMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCICNPGVVRQFRNPDTIFILAF
AIILLNTDMYSPNVKPERKMKLEDFVKNLRGVDDGEDIPREMLVGIYERIRKRELKTNED
HVSQVQKVEKLIVGKKPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDPNKPQKLGLHQRE
IFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGVRLTSAIPGADIK
VLINFNAPNPQDRKKFTDDLRESIAEVQEMEKYRIESELEKQKGVVRPSMSQSSGLKKDA
GNGNLSRASLDDSYAIGEGLKRSALSSSLRDLSDAGKRGRRSSAGSLDSNMEGSIISSPH
MRRRAPSTRDCPSRHSAQSLPNSSSLLGSLFGTRRVKSPSPTPQPQLHPTLISHTPHPAN
LHHTARVETEGPVPMHPHHAQFCHMTQNPPPYHHHHHYHPPAHLQHPPHQYHPPPSHSQQ
QPYPAHPHGPHGHGSHPPHSSTHPTHGPPHHHGAPPPSSQGPSSTKPKHSGISTVV
Download sequence
Identical sequences I3J5F2
ENSONIP00000004092 ENSONIP00000004092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]