SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005902 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005902
Domain Number 1 Region: 227-462
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-69
Family Nuclear receptor ligand-binding domain 0.0000000522
Further Details:      
 
Domain Number 2 Region: 7-92
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.2e-31
Family Nuclear receptor 0.0000961
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005902   Gene: ENSONIG00000004686   Transcript: ENSONIT00000005906
Sequence length 474
Comment pep:known_by_projection scaffold:Orenil1.0:GL831234.1:982896:992716:-1 gene:ENSONIG00000004686 transcript:ENSONIT00000005906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNAMYSCSRQRNCLIDRTNRN
RCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQSQECGGIGAREEKSDTAD
HGRTYRRGSSATLSDLDDITTLPEGLLFDLPLTPEDGGGDYYNLDMMGGSAGSGSSSQSS
PEQTSLDFGDGNHSIKHEYQLLRDSGLFSHAIFNPLPDGCSLLEIERVAQNVVKSHIETN
QYTSEELKRMAWTLYSPEETRSYQTKSAEAMWQQCAVHITNAIQYVVEFAKRISGFMDLC
QNDQIILLKAGCMDVLLIRMCRAYNPINNTVFFDGKFSTPQLFKALGCDDLVNAVFDLAK
SLSRIQMSDEEIALFSAAVLLSPDRPWLTDVQKIQKLQEKVYVALQRCLQREGASEEKLA
KMVSKLPTMRSICNLHIDKLEFFRLVHPETAYMFPPLYREVFGSEITFPDSTEG
Download sequence
Identical sequences I3JAL2
ENSONIP00000005902 XP_005478800.1.78416 ENSONIP00000005902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]