SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005960 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005960
Domain Number 1 Region: 87-214
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.95e-25
Family Glutathione S-transferase (GST), C-terminal domain 0.0065
Further Details:      
 
Domain Number 2 Region: 4-90
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.33e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005960   Gene: ENSONIG00000004733   Transcript: ENSONIT00000005964
Sequence length 226
Comment pep:known_by_projection scaffold:Orenil1.0:GL831202.1:3060102:3063311:-1 gene:ENSONIG00000004733 transcript:ENSONIT00000005964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKAMTLLWGAGSPPCWRVMIALEEKNLQGYNQKLLSFDKMEHKSKEVLDINPRGQLPTF
KHGNTIVNDSYAVCFYLESKFKSQGNKLIPDSQEEQALMYQRMFEGLTFYDKLNAVIYYD
WFVPEGERHESALNRNKEALTTELKLWEGYLQKLGSGSHVAGPSFTLADVVIFPTVAYLF
RFGLSAKRYPKLGEYHNLLKDRPSVKASWPPHWLENPEGQDTLKDI
Download sequence
Identical sequences I3JAS0
ENSONIP00000005960 ENSONIP00000005960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]