SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006331 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006331
Domain Number 1 Region: 56-196
Classification Level Classification E-value
Superfamily C-type lectin-like 1.68e-44
Family C-type lectin domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006331   Gene: ENSONIG00000005034   Transcript: ENSONIT00000006336
Sequence length 199
Comment pep:novel scaffold:Orenil1.0:GL831289.1:1640712:1642206:1 gene:ENSONIG00000005034 transcript:ENSONIT00000006336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMAERVALVVLCILLAAALIVIYRLNFNSAFENTKIRESLKKLEDHRMKCENVLKGDSCS
KCEEGWEQHGGKCYYFSTSKSSWNKSRDDCRAKGGDLVKIDSREEQEFLWKKVRRMMTDH
EDKFWIGLTDSAEQGRWLWVDGSPLNKSLSYWNDSGPDNWPEDDCVLMGDKGDRYLKSWS
DASCKVSHRSICEKPAAKG
Download sequence
Identical sequences I3JBU1
ENSONIP00000006331 ENSONIP00000006331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]