SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006686 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006686
Domain Number 1 Region: 61-254
Classification Level Classification E-value
Superfamily Sec7 domain 3.01e-81
Family Sec7 domain 0.00000000722
Further Details:      
 
Domain Number 2 Region: 262-382
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-32
Family Pleckstrin-homology domain (PH domain) 0.00000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006686   Gene: ENSONIG00000005316   Transcript: ENSONIT00000006691
Sequence length 399
Comment pep:known_by_projection scaffold:Orenil1.0:GL831217.1:1814709:1840464:1 gene:ENSONIG00000005316 transcript:ENSONIT00000006691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLKSEDGVVPDDLTPEEQQELENIRRRKQELLEDIQRLKNEIAEVTSEIENLGSTEERK
NMQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTSDDIAQFLYKGEGLNKTAIGDYLGE
RDDFNIKVLQAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMETFAQRYCHCNPG
VFQSTDTCYILSFAIIMLNTSLHNPNVKDKPTVERFISMNRGINDGGDLPEDLLRNLYES
IKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTD
KEPRGIIPLENLSIKEVEDKKPNCFELFIPDSKDQVIKACKTEADGRVVEGNHTFYRISA
PTAEEKEEWMKSIKAAISRDPFYEMLAARKKKVSSMKRH
Download sequence
Identical sequences I3JCU6
ENSONIP00000006686 ENSONIP00000006686 XP_005454990.1.78416 XP_006791459.1.46954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]