SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007090 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007090
Domain Number 1 Region: 266-508
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-64
Family Nuclear receptor ligand-binding domain 0.0000000328
Further Details:      
 
Domain Number 2 Region: 153-234
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.83e-28
Family Nuclear receptor 0.0000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007090   Gene: ENSONIG00000005633   Transcript: ENSONIT00000007095
Sequence length 557
Comment pep:known scaffold:Orenil1.0:GL831178.1:817459:839623:-1 gene:ENSONIG00000005633 transcript:ENSONIT00000007095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAAASSPEKLLQLQEVDSSRAGSRILSPILGSSSPGLSHETSQPICIRSPYTDLGHDFT
TIPFYSPTIFSYGGPSISECSSVHQSLSASLFWPSHGRVGTPITLHCPQGRSQQGQSAQT
PWDSVITTSKSVRRRSQESEESMVSSGGKADLHYCAVCHDYASGYHYGVWSCEGCKAFFK
RSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMTKCGIRKERGNYRNSQARRL
TRLSSQGKTAEPKGITGPAEGSLNKPEKPALTPEQLIERILEAEPPEIYLVKDAKRPLTE
ASVMMLLTNLADKELVHMISWAKKIPGFVELSLVDQVHLLECCWLEVLMIGLMWRSVDHP
GKLIFCPDLSLSREEGSCVQGFVEIFDMLIAATTRVRELKLQREEYVCLKAMILLNSNMC
LSSSDCSEDLQSRSKLLRLLDAMTDALVLAIGKTGLTFRQQYTRLAHLLMLLSHIRHVSN
KGMDHLHCMKMKNIVPLYDLLLEMLDAHIMHSSCLPHQPPQQDSKDQSEVPAPLHSSAGG
PSNTWTPSSARAGGESQ
Download sequence
Identical sequences Q9YH32
ENSONIP00000007090 ENSONIP00000007090 NP_001266703.1.78416 XP_005475012.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]