SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007340 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007340
Domain Number 1 Region: 225-462
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.8e-71
Family Nuclear receptor ligand-binding domain 0.00000000927
Further Details:      
 
Domain Number 2 Region: 113-200
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.17e-29
Family Nuclear receptor 0.0000994
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007340   Gene: ENSONIG00000005828   Transcript: ENSONIT00000007345
Sequence length 464
Comment pep:known_by_projection scaffold:Orenil1.0:GL831227.1:1413121:1421902:1 gene:ENSONIG00000005828 transcript:ENSONIT00000007345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTLSVTDIPDVGHDESKVFDGASELQLDCMVEESSGSTTMKHDGLLSLTDLSHPDDFPV
PPHNGPSLAEMSSPLPVEPNDIKLDPAAGDTSASTDGQPVKRKKGPAPKMLGNEVCSVCG
DKASGFHYNVLSCEGCKGFFRRSVIKSAQYSCKNNGRCEMDMYMRRKCQQCRLRKCREAG
MLEQCVLSEEQIRLKKLKKQQEEETARTSTVVTPTPPQEAATLDPQQQEMIQKLVAMQKQ
CNKRSFLDRPKVTPWPQSQDLQNREVRQQRFAHFTELAIMSVQEIVDFAKQLPGFLELTR
EDQIALLKTSTIEIMLLETSRRYNPAIESITFLKDFSYNKEDFAKAGLQFEFINPIFEFS
KGMNDLHLDEAEYALLIAINIFSADRPNVQDHELVERLQQPYVDALRSYIMIKRPNDHLM
FPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVNE
Download sequence
Identical sequences I3JEP9
ENSONIP00000007340 XP_005455771.1.78416 XP_005455773.1.78416 XP_005455774.1.78416 XP_005455775.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]