SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007440 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007440
Domain Number 1 Region: 122-365
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.46e-52
Family Nuclear receptor ligand-binding domain 0.000000409
Further Details:      
 
Domain Number 2 Region: 54-137
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.24e-29
Family Nuclear receptor 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007440   Gene: ENSONIG00000005911   Transcript: ENSONIT00000007445
Sequence length 420
Comment pep:novel scaffold:Orenil1.0:GL831150.1:3394185:3402656:-1 gene:ENSONIG00000005911 transcript:ENSONIT00000007445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLTGAILKLECTHGSTETKLLNNMMLVPLRANKTGSLGSASSSSLSGTDGAKTQCSICA
DRATGKHYGAPSCDGCKGFFRRSIRNNHTYSCRFDRQCIVDKDKRNQCRYCRLRKCFKAG
MRKEAVQNERDCINSQRAKEQTVGTLSISVLLQAETTVQQFPALLSPRSHDITTKKTAGV
GEVFESMKQQLLLLVEWAKHIPEFCSLPIDDRVTLLRTHSAEHLILGAARRSLPYNNVIL
LGNDFVIPLRGAEVEISRVAFRIQEELVKPLRELVITDKEFACLRTIVFFAPDCSGLKSP
QVVRHLRFQAHLLLEEATCEQRGRFGELLLILPPLQSVAWQMVETLHLAQLLGEAKMDSL
LQEMLLGEGTETGQGVCTGNDPTQDQQNDLNASPATFPSVICQASMTPTSGFLAAHTDWH
Download sequence
Identical sequences I3JEZ9
XP_003442411.2.78416 ENSONIP00000007440 ENSONIP00000007440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]