SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007839 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007839
Domain Number 1 Region: 263-502
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-63
Family Nuclear receptor ligand-binding domain 0.000000412
Further Details:      
 
Domain Number 2 Region: 32-115
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.69e-30
Family Nuclear receptor 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007839   Gene: ENSONIG00000006222   Transcript: ENSONIT00000007844
Sequence length 514
Comment pep:known_by_projection scaffold:Orenil1.0:GL831229.1:1303535:1322887:1 gene:ENSONIG00000006222 transcript:ENSONIT00000007844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYEEPDVPSADTPIKRGGAVSKKSHLTQIEVIPCKICGDKSSGVHYGVITCEGCKGFFR
RSQLPTVSYSCSRQSNCQIDRASRNRCQHCRLQKCLAQGMSRDAVKFGRMSKRQRDSLIA
EVERHRQQQQQQLQGDAQTVLSYPNKNRQDRSPQLLQPMAPTYPYSGDAELLTYAADVHP
YLMCSPNDSQVPAMIYRTSGISPTSRSQGRGDNAGHADIRGEAQMQSSHDMMGIHPYSGL
EDPYSLYPHSLRNIGEQMSTVSQTKHELCASIVRSHRETSQYRVEELQALRWKLFSREEI
QTYQSKSVDEMWQHCAIRLTDAVQFVVEFAKHIPGFRMLSQNDQIALLKTGSMEVVLVRM
SRFFNTENNTVFFDGKFAGTEVFKSLACGDLIAAVFDFAHGMCALKLTEQQIALFSALVL
INADRPCLEDRGKVQRVQRSVELGLTHILHRDNQESLMHKLYQRMAVLRSLCSLHMEKLR
WFSQRYPLTAHSLFPPLYKELFASEAELLPGTTH
Download sequence
Identical sequences I3JG48
ENSONIP00000007839 ENSONIP00000007839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]