SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007963 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007963
Domain Number 1 Region: 82-364
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.21e-71
Family Nuclear receptor ligand-binding domain 0.00000000551
Further Details:      
 
Domain Number 2 Region: 30-108
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.67e-26
Family Nuclear receptor 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007963   Gene: ENSONIG00000006314   Transcript: ENSONIT00000007968
Sequence length 414
Comment pep:known_by_projection scaffold:Orenil1.0:GL831179.1:1589507:1594773:1 gene:ENSONIG00000006314 transcript:ENSONIT00000007968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLAAIETESTSSGEDLLVPSPPSPPPPPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRR
SIQKNMVYTCHRDKVCVINKVTRNRCQSCRLQKCLDVGMSKELVRNDRTKKKKEEKKQPD
TEIYVLSADTEQMIERVRRAHQDTFPSLCQLGFSSILQSNSSEHRVALDVSLWDKFSELS
TKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPDQDTMTFSDGLTL
NRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLLCGDRQDLEESEKVDILQ
EPMLEALKLYVRRRRPDKPCMFPKILMKITDLRKRFLLGAERVITLKMEIPGSMPPLIQE
MLENSEGLEGHGAGGGKGRGGARREVEEESGSCRSSPMHKPVHFSSPSPAPRSP
Download sequence
Identical sequences I3JGH2
ENSONIP00000007963 ENSONIP00000007963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]