SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008140 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008140
Domain Number 1 Region: 162-403
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.73e-71
Family Nuclear receptor ligand-binding domain 0.00000000153
Further Details:      
 
Domain Number 2 Region: 49-137
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.56e-28
Family Nuclear receptor 0.00000855
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008140   Gene: ENSONIG00000006456   Transcript: ENSONIT00000008145
Sequence length 408
Comment pep:known_by_projection scaffold:Orenil1.0:GL831179.1:3031615:3052316:1 gene:ENSONIG00000006456 transcript:ENSONIT00000008145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHILQPYCINRWPDVPKRKRKNSQCSVKSMSALSVSVPGYIPSYLEKDEPCVVCGDKATG
YHYRCITCEGCKGFFRRTIQKNLHPSYSCKYEGCCIIDKITRNQCQLCRFKKCISVGMAM
DLVLDDSKRVAKRRLIEENREKRKKEEMMRMLQTRPEPDTAEWELIRMVTEAHRHTNAQG
SSWKQKRKFLPDDIGQGPMVPTSDGDKVDLEAFSEFTKIMTPAITRVVDFAKKLPMFSEL
PCEDQIILLKGCCMEIMSLRAAVRYDPDSETLTLNGEMAVKREQLKNGGLGVVSDAIFDL
GKSLAQFNLDDSEVALMQAVLLMSSDRSGLTSMEKIEQCQEAYLLAFEHYINYRKHNIPH
FWPKLLMKVTDLRMIGACHASRFLHMKVECPNELFPPLFLEVFEDQEV
Download sequence
Identical sequences I3JGZ9
ENSONIP00000008140 XP_013127541.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]