SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008264 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008264
Domain Number 1 Region: 75-268
Classification Level Classification E-value
Superfamily Sec7 domain 6.41e-79
Family Sec7 domain 0.0000000124
Further Details:      
 
Domain Number 2 Region: 277-392
Classification Level Classification E-value
Superfamily PH domain-like 2.23e-33
Family Pleckstrin-homology domain (PH domain) 0.000000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008264   Gene: ENSONIG00000006550   Transcript: ENSONIT00000008269
Sequence length 417
Comment pep:known_by_projection scaffold:Orenil1.0:GL831229.1:2650964:2667126:1 gene:ENSONIG00000006550 transcript:ENSONIT00000008269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFDSELFMPKSKAPKMDDLDYIPVDLSPEERSELEDIRRRKGVLLQEIQRLREELREAI
LEVEGLETSTEGSKTLQKSRHVAMGRKKFNMDPKKGIAFLVENELLRHTPEDIAQFLYKG
EGLNKTAIGDYLGERDDFNIKVLQAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRM
MEAFAQRYCHCNPGVFQSTDTCYVLSFAIIMLNTSLHNPNVRDKPGVDRFISMNRGINEG
GDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLAGGRVKTWKRRWFI
LTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYIPNNRGQLIKACKTEAD
GRVVEGNHMVYRISAPTPEEKDEWIHSIKSAVSVDPFYEMLAARKKRISLKKKEEQP
Download sequence
Identical sequences I3JHC0
ENSONIP00000008264 ENSONIP00000008264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]