SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008414 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008414
Domain Number 1 Region: 42-293
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.37e-67
Family Nuclear receptor ligand-binding domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008414   Gene: ENSONIG00000006662   Transcript: ENSONIT00000008419
Sequence length 294
Comment pep:known scaffold:Orenil1.0:GL831237.1:231838:233611:1 gene:ENSONIG00000006662 transcript:ENSONIT00000008419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATLEGCRCRGASGRNNNSSSSILYSILKSDDRLVTAEEQQQHPQQHTLQHLFQKPPSSS
ASASLQEVRQQACSCGSTRRRGVLRSPQVTCKAASAVLVKTLRFVKNVPCFRELPEDDQL
VLIRSGWAPLLVLGLAQDRVDFETTETVEPSMLQRILTGCPDRQSEAVGGQNRGAPGVSV
VDIEAIKAFLKKCWSVDISTKEYAYLKGAVLFNPDLEGLRCLHYIQSLRREAHQALNEHV
RLIHREDTTRFAKLLIALSMLRAISPPVVAQLFFRPVIGTVNIEEVLMEMFYGK
Download sequence
Identical sequences I3JHS0
ENSONIP00000008414 ENSONIP00000008414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]