SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008529 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008529
Domain Number 1 Region: 236-345
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 5.75e-33
Family Elongation factor TFIIS domain 2 0.0049
Further Details:      
 
Domain Number 2 Region: 2-92
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1.44e-26
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.000035
Further Details:      
 
Domain Number 3 Region: 369-412
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 2.32e-16
Family Transcriptional factor domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008529   Gene: ENSONIG00000006755   Transcript: ENSONIT00000008534
Sequence length 414
Comment pep:known_by_projection scaffold:Orenil1.0:GL831244.1:589888:603096:-1 gene:ENSONIG00000006755 transcript:ENSONIT00000008534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTREEDLIRIAKKLDKMVSRNNTEGAIDLLKELKGVNMTLKLLQETRIGMSVNGIRKHCT
DEEVIALAKVLIKDWKRLLDSGRSHPEKSSETKNGLNSSKTAASPNSSPSETQSRKEPPD
PNAPLPPLPLHLHPPPPKRPSLDGKKKDSSDSKSPPPKKPALEAKKDKHRKDSCESKPGQ
PVKRHSADSVSLLRRESTDSKTISSPAAKKLTGERKSKSEAPKTPTTPTSPMSPSFSSPG
GPLSPHLTTGDSIRDKCIEMLAAALRTDNDYKEFGANCESMGAEIEDHILQEIKATDMKY
KNRVRSRISNLKDPKNPGLRKNVLAGSIELRRIATMSAEEMASDELKQLRNVLTQEAIRE
HQMAKTGGTTTDLLQCGKCKKKNCTYNQVQTRSADEPMTTFVLCNECGNRWKFC
Download sequence
Identical sequences I3JI35
ENSONIP00000008529 ENSONIP00000008529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]