SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008879 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008879
Domain Number 1 Region: 274-443
Classification Level Classification E-value
Superfamily Sec7 domain 4.32e-42
Family Sec7 domain 0.00015
Further Details:      
 
Domain Number 2 Region: 489-623
Classification Level Classification E-value
Superfamily PH domain-like 2.33e-27
Family Pleckstrin-homology domain (PH domain) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008879   Gene: ENSONIG00000007035   Transcript: ENSONIT00000008884
Sequence length 751
Comment pep:known_by_projection scaffold:Orenil1.0:GL831381.1:224017:255054:-1 gene:ENSONIG00000007035 transcript:ENSONIT00000008884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRRTLKYSETDLDAVPLRCYRETDLDEVMRAEAAEEADSAFGSNRSVLGNSNFNPADPSP
KPHPGGRKEVDGEEEEEDEEDEEEGGVEEEVLSLLLKGSPESSDTHGGLKSPISIGSPRR
PSDSNLDSFSRHFESIMESHRAKGTSYSSLDSVDLLTSGSTSVFTFDLPTLTPEIQSTPP
PLQALLRPLSLQIAVLSADSCLTSPQPIEGNSRWSEAGWNRGSGESVPTDSHVKTDTQTG
LGSVPINKERPLNRPPELLYPQADVAERLALGGSDDALANGMKPDLQAAKRLAKRLYNLE
GFRKSDVARQLSKNNEFSQMVAEEYLTNFDFTGLTIDQALRTFLRQFALMGETQERERVL
AHFSRRYRQCNSESLTSEDSVHTLTCAIMLLNTDLHGNSVTITSEVYPPHRSVEVVDAGS
RIPLYSLQTLYSSIKNEKLQWTIDEEELRKSMSELADVRTDSASHTMKRLGSSGNPLVGV
AHQADGELYKSGFLVRKVHADPDGKRTPRGKRGWKSFYAMLKGMVLYLQKDEYRAEKELT
EEDVKNAVSIHHSLAMRAADYSKRPNVFYLRTADWRVFLFQAPNAEQMQSWITRINVVAA
MFSAPPFPAAIGSQKKFSRPLLPGSNTKLSQEEQVKSHENRFRAVSSELSDLTASTPDRK
VKGRELEEQKLRQEYLEFEKTRYGTYAMLLRAKLASGDEDLSAFEARLFDDGGLQRAHSS
PSLPQDTANKEKTRGSKTSKSLKVTSSSTSK
Download sequence
Identical sequences I3JJ35
ENSONIP00000008879 ENSONIP00000008879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]