SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008967 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008967
Domain Number 1 Region: 113-127,155-161,231-435
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-66
Family Nuclear receptor ligand-binding domain 0.0000289
Further Details:      
 
Domain Number 2 Region: 43-128
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.77e-29
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008967   Gene: ENSONIG00000007109   Transcript: ENSONIT00000008972
Sequence length 435
Comment pep:known_by_projection scaffold:Orenil1.0:GL831285.1:380236:386310:1 gene:ENSONIG00000007109 transcript:ENSONIT00000008972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDHLTKIPMMPSSSPTESSGSGGTDDSRGAKSPAPGKALSPALVCKVCGDTSSGKHYGI
YACNGCSGFFKRSVRRRLIYRCQAGTGMCPVDKAHRNQCQACRLKKCLQAGMNKDAVQNE
RQPRSTAQVRLDSIDVDPEKEHLATTREPTSSSSSSSSSSSSSSSNGSVITWPHITSSMS
ISSSVATQRCISPQNNHRFMASLMTAETCAKLEPEDVDENIDVTSNEPERASSEYHMALY
PSGSENVYETSARLLFMSVKWAKNLPVFSNLPFRDQVILLEEAWSELFLLCAIQWSLPLD
SCPLLSLPDLCPGMQGKTSYTSLDLRLLQEVFSRFKALAVDPTEFACLKAIVLFKPETRG
LKDPEQVENLQDQSQVMLGQHIRSHYPSQPARFGKLLLLLPSLRFVNSERIELLFFHRTI
GNTPMEKLLCDMFKN
Download sequence
Identical sequences I3JJC3
XP_003454374.2.78416 ENSONIP00000008967 ENSONIP00000008967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]