SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009959 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009959
Domain Number 1 Region: 345-575
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.19e-29
Family RecA protein-like (ATPase-domain) 0.014
Further Details:      
 
Domain Number 2 Region: 174-286
Classification Level Classification E-value
Superfamily DNA primase core 0.0000366
Family Primase fragment of primase-helicase protein 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009959   Gene: ENSONIG00000007901   Transcript: ENSONIT00000009965
Sequence length 612
Comment pep:known_by_projection scaffold:Orenil1.0:GL831265.1:182294:186592:-1 gene:ENSONIG00000007901 transcript:ENSONIT00000009965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PITVTDIKQYLRSKDIPFHDGYSCLHIPSIFVDLSTRKEVFSLFIDKTTGQFLCKDTLVE
GSWEDLQDCLEVMQKDGEESLNPNVLLGYPESVEEQEERERELREVQRIWSTSVPLTDLP
EDEAQLIKTMFQITKISNATLKKFGVRLFKPTKSLVFPWFGGPDSSLKGVKLLSAQRTET
DKVTYNEATVPKSNSYYNLFGLPLVGRLDSEVVVTGHEFDTMAVSQATGLPSVALPRGVS
CLPPILLPYLEQFKRVTLWLGGDIRSWEASKSFSRKLGIRRCSLVRPGEYRPCAVEALAR
GKNLSNIIKASIPAAHKSIVSFKQLREDVYGELVNTDQVAGVKWTRFPELNRILKGHRKG
ELTVFTGPTGSGKTTFISELALDLCMQGVNTLWGSFEINNVRLAKIMLTQFAMQRLEENL
EHYDFWADKFEELPLYFMTFHGQQNIKTVLDTMQHAVYLYDINHVVIDNLQFMMGQENLS
VDKFAVQDHIIGVFRKFATNSSCHVTLIIHPRKEEDDRELQTASIFGSAKASQEADNVLI
LQEKKLVTCPGRRSLQVTKNRFDGDVGIFPLDFIKSSLTFSTPIKGKHKLRKVNTKPENE
EEDEATAAASKK
Download sequence
Identical sequences I3JM65
ENSONIP00000009959 ENSONIP00000009959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]