SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010234 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010234
Domain Number 1 Region: 65-170
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.64e-30
Family Thioltransferase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010234   Gene: ENSONIG00000008126   Transcript: ENSONIT00000010243
Sequence length 172
Comment pep:known_by_projection scaffold:Orenil1.0:GL831154.1:744064:746694:1 gene:ENSONIG00000008126 transcript:ENSONIT00000010243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHRLLLRRLWTLSVNDIRCLPRSTASVASSCYSTSLQSTTTRVSFLSPSRSLPRALPHT
SRREVSFNVQDSEDFTERVINSELPVLVDFHAQWCGPCKILGPRLEKAVAKQKGRVAMAK
VDIDDHTDLAIEYGVSAVPTVIAMRGGDVVDHFVGIKDDDELDSFVSKVIGQ
Download sequence
Identical sequences I3JMZ0
XP_003443120.3.78416 ENSONIP00000010234 ENSONIP00000010234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]