SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010662 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010662
Domain Number 1 Region: 532-788
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-62
Family Nuclear receptor ligand-binding domain 0.0000000143
Further Details:      
 
Domain Number 2 Region: 437-525
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-22
Family Nuclear receptor 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010662   Gene: ENSONIG00000008483   Transcript: ENSONIT00000010671
Sequence length 803
Comment pep:known scaffold:Orenil1.0:GL831184.1:1493772:1551621:-1 gene:ENSONIG00000008483 transcript:ENSONIT00000010671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQGGLKRNGNRDDGLTFAEIGGTGDTPGSLFQSAMHLPGSLPPATVAPNRQGGTNGQGE
LGGLFESHQHHVLGEGTDMKESKMIRMQKQQQQQQQDIGIFGMGDSLPLFNQCISDTPTS
VINTSDTSVLGNLPLPDLFSHPIKTESILSLDKDLGTYSGHTGTGLCDLDGNSGRLIEDT
EIWQDLDLPSSLPEISAFELDSEVAHLDNILQESAGGGCPVSGLPKEIKPLMGNGENCTS
VNGTEQQHHALHPHQQQQQQQHHQLIHHQQHQPQHHQPQALLSTVIIKEEKDPDESFIQI
CTPGVIKQEKQDSAFCQPQCLQSSISSLQGGGPGPMSSPVGVGAVPGYHYRANPSSTMGI
QDQKPFDMYSNMPLMGDGWARGKRYGETSGIQSSDDGLTPVASLAPFSVGFSSSSPREGE
ISSSVVPAQSKTSGQTHKICLVCSDEASGCHYGVVTCGSCKVFFKRAVEGWRARQNTDGQ
HNYLCAGRNDCIIDKIRRKNCPACRFRKCLQAGMNLEARKNKKLIKMKVHRAGASEPTIS
NMPVPVVPRSMPQLVPTMLSILKAIEPEIIYSGYDSTLPDTSSRLMSTLNRLGGQQVVSA
VKWAKSLPGFRNLHLDDQMTLLQCSWLFLMSFSLGWRSYEQCNGSMLCFAPDLVINKDRM
KLPFMTDQCEQMLKICNEFVRLQVSYEEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMTYI
KELGKAIVKREENPSQNWQRFYQLTKLLDSMQEMVEGLLQICFYTFVNKTLSVEFPEMLA
ELISNQIPKFKDGSVKALLFHQK
Download sequence
Identical sequences I3JP68
ENSONIP00000010662 XP_003446987.1.78416 ENSONIP00000010662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]