SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010770 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010770
Domain Number 1 Region: 186-200,358-599
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-59
Family Nuclear receptor ligand-binding domain 0.000045
Further Details:      
 
Domain Number 2 Region: 117-199
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.89e-30
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010770   Gene: ENSONIG00000008566   Transcript: ENSONIT00000010779
Sequence length 611
Comment pep:known_by_projection scaffold:Orenil1.0:GL831160.1:2154441:2161845:-1 gene:ENSONIG00000008566 transcript:ENSONIT00000010779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGQTQRFQLVSADNNMALGHRIQIVTDQQTGQKIQIVTALEPSSPGKQQFILANADYSP
GGKVILAKQEGSPNKVILTTPDGSGVNQLLFASPELTGQQIQFVTESSDQSIVKPVVEYC
VVCGDKASGRHYGAVSCEGCKGFFKRSIRKNLVYTCRGSGECAINKLHRNRCQYCRLQRC
IALGMKQDSVQCERKPVEVTAREKSVNCAASTEKIYIRKNLCSPLAATPTFASDKETARS
ASLLESSMLLNIQQPFSKLENTILIPASPEKQEDPSQGDLGTLANVVTSLAHLNKSREAS
DSGNDLMGAETLSNGDSSMTDIQGDEQTASDISRAFDTLAKVLHPGDGSAGESLEATMQL
MSGDQSGPVVELEGPLLSDSHIPFKLMMPLPVPEYLNVNYICESASRLLFLSMHWARSIP
AFQTLGGQDNDINLMKFCWNELFALGLAQCSNVMNVGTILSAIINHLQTSLQEEKLSPER
GKIVMEHIWRMQEFCNSMSKLSPDSYEYAYLKAIVLFSPDHPGIDNIPQIERFQEKAYME
LQDYVTRTYPEDSYRLSKLLLRLPALRLISAAVTEELFFAGLIGNVQIDSIIPYILKMES
TDYNSQAVSAV
Download sequence
Identical sequences I3JPH6
XP_005450993.1.78416 XP_005450994.1.78416 XP_019217278.1.78416 XP_019217279.1.78416 ENSONIP00000010770 ENSONIP00000010770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]