SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010933 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010933
Domain Number 1 Region: 149-175,382-598
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.11e-64
Family Nuclear receptor ligand-binding domain 0.0000196
Further Details:      
 
Domain Number 2 Region: 95-185
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.5e-29
Family Nuclear receptor 0.0000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010933   Gene: ENSONIG00000008699   Transcript: ENSONIT00000010942
Sequence length 599
Comment pep:known_by_projection scaffold:Orenil1.0:GL831154.1:5742197:5750426:1 gene:ENSONIG00000008699 transcript:ENSONIT00000010942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEDIGTAKPGGVIAYISSRSAPSPESCMSSSSSSGYLSTSPTPSRPSLPSRAVGMVVDI
APPGKNGSPRGHGGEKAGRSSASAKSSITKINGMVLLCKVCGDVASGFHYGVHACEGCKG
FFRRSIQQNIQYKKCLKMENCTIMRINRNRCQQCRFKKCLAVGMSRDAVRFGRIPKREKQ
RMLLEMQNAMNNMMSNNSQLHSMLQGHQSPPLPMEAMTSDSNSFPSSSSSSSASDSPSCS
NPSSPQCPQDSESVVSMDTTSSSSCSSDSGEDEALVTLNRQHQDALAFTQQRSPTQGQTS
PATVSVETGCESRMEKQQDRWNCWNNSVAVRDYQNCPYSSGQQVTNPAYRGEREGYQQQF
NSTPSCEQSEDSQRQQTELHTQSASNGYNGPTSCVNNRAHLLCPMNTSPYVDPSKPSQEV
WEEFSMSFTPAVREVVEFAKGIPGFRDLPEHDQVGLLKAGTFEVLMVRFASLFNIAEQTV
TFLSGKCYSLDTLRSLGAGELLNSMCEFSEKLAALRLSADEMSLFTAVVLVSADRSGIQD
LKSVEALQDKLIRALRNLVMQNHGDESATTFTKLLLKLPELRSLNNMHSEELLSFKVHP
Download sequence
Identical sequences I3JPY9
XP_003443106.1.78416 ENSONIP00000010933 ENSONIP00000010933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]