SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011485 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011485
Domain Number 1 Region: 631-827
Classification Level Classification E-value
Superfamily Sec7 domain 4.32e-65
Family Sec7 domain 0.0000141
Further Details:      
 
Domain Number 2 Region: 50-139,200-242,350-551,884-979,1038-1153,1484-1622
Classification Level Classification E-value
Superfamily ARM repeat 0.000000062
Family Armadillo repeat 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011485   Gene: ENSONIG00000009136   Transcript: ENSONIT00000011494
Sequence length 1798
Comment pep:known_by_projection scaffold:Orenil1.0:GL831300.1:424077:464986:-1 gene:ENSONIG00000009136 transcript:ENSONIT00000011494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SELSDVEPNVFLRPFLEVVRSEDTTGPITGLALTSVNKFLSHGLIDANHEAAAEAIENMA
DAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRL
SELLRKTAEHTLVDMVQLLFSRLPQFKEEAKSYVGANMKKLKMRAGGMSESSKWKKQKRS
PRPPRHMVRSSSGQMEPSQPSTLNNNLSGGVPFMEEGLSNPSLPVSDSSASSICSPTATD
SGLGTCSKTTSREDLSDLDQCSSASTAGAAIALTGTESGSTDAQFEGQQAEPAPSASVES
IPEVLEDKDSITEQSDSASVHDMDYVNPRGVRFTQSTQRDGASLIPYGLPCLRELFRFLI
SLTNPHDRHNTDAMMHMGLQLLTVALESAHIPNYQSLLVLVKDELCRHLFQLLSVDRMNL
YASSIRVCFLLFESMRAHLKFQLEMYLKKLIDIITSENIKMPYEMKEVALEALVQLWRIP
SFVTELYINYDCDFYCSNLFEDLTKLLSKNAFPVSGQLYTTHLLSLEALLTVIDSIEAHC
QARVLNSIAQQNQAETVLADGEGAAKAETDSAAGISTLSQPEKAPVYPPTSGHLMAEKMR
LGRQDQGDSDPSEKRSLKKPQRFLSCLPDSHELMEIRTKKKLLITGTEQFNQKPKKGIQF
LQEKGLLSSPIDNNQVAQWLRENPRLDKKMIGEYISDRKNTELLDSFVNTFTFQGLRIDE
ALRLYLEAFRLPGEAPVIQRLLETFTDNWHKVNGFPFMSNDAGFALAYAVIMLNTDQHNH
NVRKQNIPMTVEQFKKNLKGVNGNKDFDQDMLEDIYNAIKNEEIVMPDEQTGLVKENYVW
SVLLHRGASSEGIFLHLPPGSYDNDLFTMTWGPTIAALSYVFDKSLDDVIIQKAITGFRK
CAMIAAHYGFNDVFDNLIISLCKFTTLSSESVENLPTVFGSNSKAQTAAKTVFDLAHRHG
NILREGWKNIVDSLLQLFRAELLPKAMVEVEDFVEPNGKISLQREETPSNRGESAVLSVF
NWLTLSGAEQSGLRGPSTENQEAKQAAIHCIKQCDPEKLITESKFLKLESLQELMKALIS
VTPDEETYDEEDAAFCLEMLLRIVLENRDRVSCVWQTVRDHLCQLCVHANESCFLVERAV
VGLLRLAIRLLRREDISSQVLLSLRLLLMMKPHVLSRVSREVAYGLHELLKTNAANIHCT
DDWYTLFSLLECIGAGVKPPVAFQLTSATADNDTGAQSDSELSSHHPSEVSLDRGYTSDS
EVYTEHSKTRIPRSATDVDVASSGWLVVGKDDFEISKTPIPGSKAQLNHPLVNQYSLTLG
QDLGQHDTKSLIKCVETLSFIVRDAAHVTPDNFELCVRAIRVFVEASLNGGYRNHDKKKS
HKYDTSKSRMRKKAGGREKDSAGSVRRSSSRTFSQRPSRSYSDDEEDEGVPASYHTVSLQ
VSQDLLDLMHTLHTRAASIYNSWAEEQCHLEASSRKIEADSQTLWTSCWCPLLQGIAWLC
CDARRPVRMQALTYLQRALLVHDLQTLDAIEWESCFNKVLFPLLTKLLDNISPADVGGME
ETRMRACTLLSKVFLQHLSPLLSLPTFAALWLTILDFMDKYMHAGSSDLLLEAIPESLKN
MLLVMDTAGIFHSADSRTGYSDLWEITWERIVCFLPLLREELFKQTIIPDAVPNPQAESV
QLTTPAGRPPSPQVSPPPMQTPALAPVNSTVAQSSSRPASPLEPPPASANAVDQHIHPKG
PSPLGQSPLILQPLASPLQVGVPPMSLPIILNPALIEATSPVPLLPAPRSTTPSDEVQ
Download sequence
Identical sequences I3JRJ1
ENSONIP00000011485 ENSONIP00000011485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]