SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011568 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011568
Domain Number 1 Region: 124-415
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.77e-87
Family Nuclear receptor ligand-binding domain 0.0000000181
Further Details:      
 
Domain Number 2 Region: 21-109
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.17e-29
Family Nuclear receptor 0.00000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011568   Gene: ENSONIG00000009200   Transcript: ENSONIT00000011577
Sequence length 420
Comment pep:known_by_projection scaffold:Orenil1.0:GL831205.1:1989783:2051012:-1 gene:ENSONIG00000009200 transcript:ENSONIT00000011577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPMTVTTSVVGPEEFDRNAPRICGVCGDKATGFHFNAMTCEGCKGFFRRSMKRKASFTC
PFNGSCTITKDNRRHCQACRLKRCIDIGMMKEFILTDEEVQRKREMIMKRKEEEAAREAM
RPRLNEEQARIISCLVEAHHKTYDASYSDFTRFRPPVREGPVTRSASRAASLHSLSDASS
DSFNHSPESVDTKMNFSNLLMMYQDGASSPDSSEEDTKLSMLPHLADLVSYSIQKVIGFA
KMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMSWSCGGPDFKYCISDVTKAGH
TLELLEPLVKFQVGLKKLNLHEEEHVLLMAICLLSPDRPGVQDHARIEQLQDHLSEVLQA
YIRVNHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEVS
Download sequence
Identical sequences I3JRS3
ENSONIP00000011568 ENSONIP00000011568 XP_005454147.1.78416 XP_013129207.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]