SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011618 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011618
Domain Number 1 Region: 161-272
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 1.29e-34
Family Elongation factor TFIIS domain 2 0.0039
Further Details:      
 
Domain Number 2 Region: 6-89
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1.27e-24
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000984
Further Details:      
 
Domain Number 3 Region: 288-339
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 1.11e-16
Family Transcriptional factor domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011618   Gene: ENSONIG00000009237   Transcript: ENSONIT00000011627
Sequence length 341
Comment pep:known_by_projection scaffold:Orenil1.0:GL831134.1:1148894:1156033:-1 gene:ENSONIG00000009237 transcript:ENSONIT00000011627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKKEEEEVIRIAKKIDKMAQKKNGAGALDLLKELRSIPMTLELLQSTRIGMSVNAIRKQ
STDEEVTSLAKSLIKSWKKLLEIADTNSQPTEFEKNQKQTKQKKKTRIVCKNEPGAGDKA
SEEKRKEQSTPVVSPSQGSPEAKEESSSSSNSSSKSEPSEVASNTLINTFPRAPSTSDSI
RIKCREMLASALQTGDDYIAIGADCDELGAQIEEYILYEFKNTDMKYKNRVRSRISNLKD
MKNPNLRRTVLCGSVTPERMAKMTAEEMASDELKEMRKNLTKEAVRDHQMATTGGTQTDL
FTCGKCKGKSCTYTQVQTRSADEPMTTFVFCNECGNRWKVC
Download sequence
Identical sequences I3JRX3
ENSONIP00000011618 ENSONIP00000011618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]