SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011635 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011635
Domain Number 1 Region: 242-505
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-35
Family Nuclear receptor ligand-binding domain 0.0000491
Further Details:      
 
Domain Number 2 Region: 164-246
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.93e-27
Family Nuclear receptor 0.0000398
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011635   Gene: ENSONIG00000009252   Transcript: ENSONIT00000011644
Sequence length 515
Comment pep:known_by_projection scaffold:Orenil1.0:GL831205.1:2505088:2527049:1 gene:ENSONIG00000009252 transcript:ENSONIT00000011644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKAGQSDRTVKQLAQQENSVMREWTELEMSFTAGGFLSTSDGYCSAEQLQYYDMLADPL
GYPLQDPDLQLLPYSQQQYSPANLPFSHYGSPPSSAPSPSSSSSSSQFCNPPYPYSPHCL
EAPCDPSPEPHCGGLFTQGLGSVGLPLGRRSRMGSGGKSRGQDELCVVCGDKASGYHYNA
LTCEGCKGFFRRSVTKKAVYHCKSGGSCEMDMYMRRKCQDCRLRKCRAVGMLAECLLTEV
QCQSKRLRKGGKGRGQEEEENTDSRRVSSTSRLPGQALSASLTREQKYIVDRMVEAHRLY
RAQDSSNFRAFEWPCPEEVEGLSDVVSPRLQRLLQFARTVPGFDLLDFSDQISLLSVSSL
DVMFLLSAQQFSHNPTSPSPALQLFSMSTHSFLRDVESKENIHSRALISSESSEDLFAPV
LNFFHSMVALRVTEAEYTLLTATALLCSDHASLQAASCVEKMQELILDLLSRLCGAQAGA
ARGGAQRFGRLLGRLTELRTLRHNYLLLTRQQSGH
Download sequence
Identical sequences I3JRZ0
ENSONIP00000011635 ENSONIP00000011635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]