SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011740 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011740
Domain Number 1 Region: 11-208
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.8e-20
Family G proteins 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011740   Gene: ENSONIG00000009340   Transcript: ENSONIT00000011749
Sequence length 242
Comment pep:novel scaffold:Orenil1.0:GL831151.1:1353922:1357637:-1 gene:ENSONIG00000009340 transcript:ENSONIT00000011749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSTVPQGKDEQELPELRIVLFGRTTVGKSTLGGIILGDSAAFTSSDPHGERTKTCHVER
KTDSDSHSVVVVDTPGLFKMGSSEEDVVKEIKWATENVEPGPHVFLLVERLKIITSEELK
ALQVFEHTFGKRAVAYVTVVFTHKSNPRENEADIKEDMKKNEHLRELIERCQWRYFIFNI
ADRSPVQVTKLLEKITQERQDYSDFFYTPQMLQAAEKAANEERREDDRRRKASENRLAIL
EK
Download sequence
Identical sequences I3JS95
ENSONIP00000011740 ENSONIP00000011740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]