SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012187 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012187
Domain Number 1 Region: 65-255
Classification Level Classification E-value
Superfamily Sec7 domain 3.79e-74
Family Sec7 domain 0.0000000524
Further Details:      
 
Domain Number 2 Region: 263-380
Classification Level Classification E-value
Superfamily PH domain-like 1.31e-31
Family Pleckstrin-homology domain (PH domain) 0.00000801
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012187   Gene: ENSONIG00000009703   Transcript: ENSONIT00000012196
Sequence length 400
Comment pep:known_by_projection scaffold:Orenil1.0:GL831151.1:4856580:4872059:-1 gene:ENSONIG00000009703 transcript:ENSONIT00000012196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIRRKDSFLWGKAPMKLPPEQRRQSEAHKFELLDDIQKLRLEINHVMPEIHSPELKEQN
KNVVRNRKFLRGKKKFNMDSKKGVQYLVENGLLEWRAESVAEFLYKEEGLNKTAIGNFLG
EREEMHLKILKAFVGLHEFSDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAARYCGCNP
GVFQSTDTCYILSFAIIMLNTSLHNPNVKDKPTLQRFVSMNRGINNGEDLPTELLTKLYT
SIRSEPFKIPEDDGNDLTLTFFNPDREGWLLKIGGRVKTWKRRWFILTDSCLYYFEYTTD
KDPIGIIPLENLCVRALQDSSKPFCLELYNPKGQKIKACKTENKGRVVQGKHQSYKLSAA
SAEERDDWIDAIRASITKDPFYDLVTLRKRKIISNTSSKD
Download sequence
Identical sequences I3JTJ2
XP_019213182.1.78416 ENSONIP00000012187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]