SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012192 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012192
Domain Number 1 Region: 8-87
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1.83e-18
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000012192
Domain Number - Region: 408-468
Classification Level Classification E-value
Superfamily F-box domain 0.00248
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012192   Gene: ENSONIG00000009707   Transcript: ENSONIT00000012201
Sequence length 604
Comment pep:known scaffold:Orenil1.0:GL831145.1:1140299:1146520:1 gene:ENSONIG00000009707 transcript:ENSONIT00000012201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSSDVVKKIMRLKLQLSDKAEPATVLKILQKLKDLDITLDVLAETGIGKTVNSLRRHE
QAGELAKSLVKGWKKLLSKESISKNCDSSDDANFKLGKRKMDSPKGQCEGRKRKTDCEKS
QENQYVSRHDMLTQKDKMDKKKKIDRSDRKPRDCDSLLGNKNLKESQQKSRSDSREKCKD
SESGRFGSDRELNTKSEVSKEPRGGKEDDRMSGMLRSSDAQKRKRKHTTSVESEREHSKH
KKAKTNETNSDPEEPSMSFESYLNYDVTLYKRKERSGVRKLPKKPKMVPSEQQIKAPVMK
NMELAPKQRKKFLEPVMHLMNIPLPAALPVCDKPSSFDYYERKVEKEPDFSDVSEESPVF
TGQRLNRKMQVYSGAKTVFLPAMLSLYQQCIRTLQNNINLLYETGGVPFEILEPVLEKCT
PEQLLRIEECNPIYVGVTDHLWGKHCQRDFKDSKLQEYESWKEMYIRLSEERERKLKRLT
KTIVSAQSQKPKGRQVKMAFIHTVAKPPRDVRIQQEIHGTAVQQPHQPRSSYISSLNIKH
TNKKPILKVQDNRSKQTYEPSRPSSTSSGGSGTTQDARKKTILTGVAPMMAKSLKAFKKQ
LGRR
Download sequence
Identical sequences I3JTJ7
ENSONIP00000012192 ENSONIP00000012192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]