SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012885 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012885
Domain Number 1 Region: 249-487
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.51e-68
Family Nuclear receptor ligand-binding domain 0.0000000505
Further Details:      
 
Domain Number 2 Region: 7-92
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.71e-31
Family Nuclear receptor 0.0000961
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012885   Gene: ENSONIG00000010247   Transcript: ENSONIT00000012895
Sequence length 499
Comment pep:known_by_projection scaffold:Orenil1.0:GL831134.1:9590861:9602533:-1 gene:ENSONIG00000010247 transcript:ENSONIT00000012895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNAMYSCSRQRNCLIDRTNRN
RCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQKSQECVGSGSGGSATLSLP
REDGVCGSGGEDGEEGLSRSYSSGGSSSTLSDLDDIAALPDLFDLPLTPEEASEYCSLEL
LGGGGASAGNTSNSSSSSSTSSSLSNQNSPQQTILDGADIQLLHSHTHSLLGNTRALLDQ
LPDDCSITDLEHITQSIVKSHLETCQYSAEDMKRFNYVQYTPEETRTFQNKSAEWMWQQC
AHHITNAIQYVVEFAKRIAGFMDLCQNDQIILLKAGCLEVLLIRMCRAFNSNNNSIFFNG
KFAPAQFFKALGCDDLVSAVFDLGKGLCRLQLSDEEMALFSAAVLLTPDRPWLTEGQKVQ
KLQEKVYLALQHSLQKSGTSDEKLDKMVSRLPVMKSICNLHIDKLEFFRLVHPETAYSFP
PLYREVFGSEMSLPDSTDS
Download sequence
Identical sequences I3JVJ0
ENSONIP00000012885 ENSONIP00000012885 XP_005476199.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]