SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012960 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012960
Domain Number 1 Region: 363-595
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.69e-70
Family Nuclear receptor ligand-binding domain 0.0000121
Further Details:      
 
Domain Number 2 Region: 92-182
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.13e-29
Family Nuclear receptor 0.0000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012960   Gene: ENSONIG00000010308   Transcript: ENSONIT00000012970
Sequence length 597
Comment pep:known_by_projection scaffold:Orenil1.0:GL831306.1:518904:525531:1 gene:ENSONIG00000010308 transcript:ENSONIT00000012970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQDMESTKAGGVIAYISSSSSASSPESCHSDSSNGSYQSSSPPRGSPPSHGQLRQPLNPT
MAAGGQNLPRTQKGGRSSSTAKTGITKINGLVLLCKVCGDVASGFHYGVHACEGCKGFFR
RSIQQNIQYKKCLKNESCPIMRINRNRCQQCRFKKCLLVGMSRDSVRFGRIPKREKQRML
LEMQSAMNNMMNNSQLQSQLYSSQSLPIVKPLPASATEPTSDDAVPAPSCSPSSSPHSSQ
SDSSLDPEPAASMDTSPSSASPSASDSSEEEVIGSVTRAHQETFMYNQEQSSLPSQASQP
VSNLGCGLAKNPTDNQTEERQDTWDHCKSPVTVAARHSTSSLDPQGQKEVNQCPFRLSRT
AATSHFPAYTHGAFRAPSTEGSTNGSCSIALWRGGNRMHLVCPMNTSPHVDPQKSGHEVW
EEFSHSFTPAVREVVEFAKKIPGFRELSQHDQVSLLKAGTFEVLVVRFASLFDVKDRTVT
FLGGKRYSVDSLRALGAGDLLNSMFDFSEKLMNLGLSEEEMSLFTAVVLVSADRSGIENV
NSVEALQETLIRALRSLITKNHPNEASIFTKLLLKLPDLRSLNNMHSEQLLAFKVHS
Download sequence
Identical sequences I3JVR5
ENSONIP00000012960 ENSONIP00000012960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]