SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012973 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012973
Domain Number 1 Region: 33-311
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.62e-75
Family Nuclear receptor ligand-binding domain 0.00000000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012973   Gene: ENSONIG00000010320   Transcript: ENSONIT00000012983
Sequence length 364
Comment pep:known_by_projection scaffold:Orenil1.0:GL831306.1:923436:978546:1 gene:ENSONIG00000010320 transcript:ENSONIT00000012983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CHLCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFAVGMSKESVRNDRNK
KKKESPKPDLAESYELTTELETIIEKIRRAHQETFPSLCQLGKYTTNSSADHRVRLDLGL
WDKFSELATKCIIKIVEFAKRVPGFTGLTIADQITLLKAACLDILILRICTRYTPDQDTM
TFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPIEMDDTETGLLSAICLISGDRQDLEE
PSKVDQLQEPLLEALKIYVRKRRPSKPHMFPKTLMKITDLRSISAKGAERVISLKMEIPG
SMPPLIQEMLENSEGQDSQSSSSSTSAEVGPRLNSKGSRNKDAATVESPNSTDNEEGAAT
PPRI
Download sequence
Identical sequences I3JVS8
ENSONIP00000012973 ENSONIP00000012973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]