SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000013530 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000013530
Domain Number 1 Region: 239-482
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-70
Family Nuclear receptor ligand-binding domain 0.00000000208
Further Details:      
 
Domain Number 2 Region: 28-113
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.16e-31
Family Nuclear receptor 0.0000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000013530   Gene: ENSONIG00000010762   Transcript: ENSONIT00000013540
Sequence length 493
Comment pep:known_by_projection scaffold:Orenil1.0:GL831172.1:1062406:1066735:1 gene:ENSONIG00000010762 transcript:ENSONIT00000013540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSQEIPKMYRISHRWEDARRLHTAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQ
NNASYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQK
HQARLQEQRQQQTGEAEALARVYSSSLTNGLSTLNHEIGGTYANGHVIELPKGGHGNGAG
VPGGYYGMDSTQPSPDQSGLDMSGMKHIKQEPVYDLTPVPNLFSYGGYQETQLGPNNVSM
GELDRIAQNIIKSHLETCQYTTEELQQLAWQTHSYEEVKMYQSKPRDVLWQQCAIQITHA
IQYVVEFAKRISGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGMQM
FKALGCDDLVSAVFDFAKSMCSLQLTEEEIALFSAAVLISTDRPWLMEPRKVQKLQEKIY
FALQHIMQKNHMDEDALAKLISRIPTLSALCTLHTEELQAFQQLHPETVNVLFPPLYKEL
FNPDPNSAMAMPK
Download sequence
Identical sequences I3JXD5
ENSONIP00000013530 ENSONIP00000013530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]