SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014573 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014573
Domain Number 1 Region: 558-749
Classification Level Classification E-value
Superfamily Sec7 domain 1.18e-62
Family Sec7 domain 0.00000734
Further Details:      
 
Domain Number 2 Region: 759-902
Classification Level Classification E-value
Superfamily PH domain-like 8.95e-17
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014573   Gene: ENSONIG00000011571   Transcript: ENSONIT00000014584
Sequence length 1110
Comment pep:known_by_projection scaffold:Orenil1.0:GL831167.1:1881583:1997987:-1 gene:ENSONIG00000011571 transcript:ENSONIT00000014584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQEGKGGEGELQSEAQSQPQPQPELQPQPQQQQQETQPQTQPAQPQPQTEPQPQIQPQP
QPQPQPEVKPQPEPEPKAQPAPEPEPQPQVKAPSEAAPQEAPKAPSPCREEQTVAEKENQ
ESEEVVAAKTKQEVEEAQAKPREGEAAQEEEDEEGGGAKGGGAGRRASLHHTASPLRVQR
NGAGSHSAASDYELSLDLKNKQIEMLEHKYGGHLISRRAACKIQTAFRQYQLSKNFEKIR
NSLLESRLPRRISLRKVRVQNTEGFSAERALAEGCNLAGIPLVRSPSLPATVGGSLTDLE
DSFTEQVQSLAKSIDDALSNWSLKTMCSLQEGGNYQFSADSFSAAAAAAGVGGGGEGGGG
DVRDSAIHQGSVDPTDLSRSASKLMMAFRDVTVQIDSQNFRVSSSVRESSTSVTLNSGTQ
QEEASSTVTTTSTTEEELGEMEQPPLTPLDKMAFPQSPEEVVVVVPPPPREPTVAPPPQE
IVLGSSPAVEPLDVKRCGSETADNSSEQMSSSSTSTEARSTSEASSKEALQAMILSLPRY
HCENPASCKSPTLSTDVMRKRLYRIGLNLFNVNPDKGLQFLISRGFIPDTPIGVAHFLLQ
RKGLSRQMIGEFLGNSKKPFNRDVLDCVVDEMDFSGMELDEALRKFQAHIRVQGEAQKVE
RLIEAFSHSQRYCMCNPDVVQQFHNPDTIFILAFAIILLNTDMYSPNIKPDRKMLLEDFI
RNLRGVDDGADIPRDMVVGIYERIQQRELRSNEDHVTYVSKVEQSIVGMKTVLSVPHRRL
VCCSRLFEVTDVNKAQKQAAHQREVFLFNDLLVILKLCPKKKSSAAYTFCKAMGLLGMQF
HLFENEYYPHGITILSPFGSDKKQVLNFCAQSAEELLKFVEDLKESIAEVTEMEQIRIEW
ELEKQQGAKTHSVKNNGTQLELRGKQGSPSEKKKLLKGTKKSAGVNEVSIHNRLQTYQQG
PQGVTQGPAPPPQHLQLQSAASTPAHHLPLQQHHQPCVSMADLRPEALIQCQQIVKVIML
DNSSHGRMEAFLSQTPTHHHYQHHHHHSHHQLSHSAMSTPVRSPDGSHGSDGHQPPLPPP
PPPYNHPHQYIPPDPRLSLHRTPSGSRSMV
Download sequence
Identical sequences I3K0C8
ENSONIP00000014573 ENSONIP00000014573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]