SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014908 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014908
Domain Number 1 Region: 141-396
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-70
Family Nuclear receptor ligand-binding domain 0.00000762
Further Details:      
 
Domain Number 2 Region: 73-153
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-30
Family Nuclear receptor 0.000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014908   Gene: ENSONIG00000011840   Transcript: ENSONIT00000014920
Sequence length 410
Comment pep:known_by_projection scaffold:Orenil1.0:GL831253.1:1978558:1985383:-1 gene:ENSONIG00000011840 transcript:ENSONIT00000014920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVVSVWRDPQEDVAGPPSGPNPAAQPAREQQQAASAAPHTPQTPSQPGPPSTPGTAGD
KGSQNSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYSCRANRNCPID
QHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISL
LLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSL
LRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKT
LHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLL
LRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSIQ
Download sequence
Identical sequences I3K1B3
ENSONIP00000014908 XP_003452669.1.78416 XP_004544446.1.88231 XP_005722415.1.53837 XP_005922893.1.24487 XP_006784158.1.46954 ENSONIP00000014908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]