SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015244 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015244
Domain Number 1 Region: 30-258
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.6e-36
Family Nuclear receptor ligand-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015244   Gene: ENSONIG00000012111   Transcript: ENSONIT00000015257
Sequence length 260
Comment pep:known scaffold:Orenil1.0:GL831144.1:5982674:5983715:-1 gene:ENSONIG00000012111 transcript:ENSONIT00000015257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCCECKVTQDTGQGSILYSILNRGALCPQARADTTAAHRCCSCASMRKLVAIRAPQSVI
RAACEVLLKTFRFVKNVPCFRGLPADDQLRLVRNSWAPLLLLGLVQDSVDFDTVETQKPS
LLHEILTHDANRRERTAGAAQHPGVPLCDVQSIQMFLVKCRGLTITVKERVSYPGCVRLV
KVPELECQEYIHALQREAERALYEHVGTVYRGNASRSGKLRVVLSTLRAVDTEAVAGLFL
RPVTGTSSIDEHVLAMFCER
Download sequence
Identical sequences I3K299
ENSONIP00000015244 ENSONIP00000015244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]