SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015382 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015382
Domain Number 1 Region: 352-576
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-66
Family Nuclear receptor ligand-binding domain 0.0000219
Further Details:      
 
Domain Number 2 Region: 115-203
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-29
Family Nuclear receptor 0.0000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015382   Gene: ENSONIG00000012213   Transcript: ENSONIT00000015395
Sequence length 579
Comment pep:novel scaffold:Orenil1.0:GL831196.1:1596719:1610453:-1 gene:ENSONIG00000012213 transcript:ENSONIT00000015395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNSPGGGGVILYAGSTGSASPSPGSPSSGYQTQSPSSHSQPSSPEEVTFTEIGALKQRA
AGCNTPSSKLVFQFPEVYSSPSTPAATPQHSYAHPIAGKRPCGFPGTFTKTGGMVLLCKV
CGDIASGFHYGVHACEGCKGFFRRSIQQNINYKMCVKNENCLIMRMNRNRCQHCRFKKCL
SVGMSRDAVRFGRIPKREKQRLLDEMQSYMNSLNESAAMDMDSPSVRESPTSTDDGTSKE
AIGAISRAYRDIFTSNSSNQERASKSGNIISSNNNNNTSPFSQDGNFPQVSSHPTSAQSY
QSCPVTPASVCPVSSNHNQPAFNNMDSNRYTYLVSSNQNHNKSNATVPQRGSSANHDSFR
IAGSTQNQPSCPWKLAPGAKVLACPLNACPVSGAERTSQEIWESFSQCFTPAVKEVVEFA
KGIPGFQELSQQDQVMLLKSGTFQVLMVRFCTLFNAGEHTVTFLNGQTYPLPTLRALGMG
SLLDAMFEFSEKLGSLGLEPDEMALFMAVVLVSADRSGISDTRAVEQLQEGLIRALRSLI
TRRRPDDTTLFSKLLLRLPDLRTLNNLHSDKLLAFRIDP
Download sequence
Identical sequences I3K2N7
ENSONIP00000015382 XP_005478101.1.78416 ENSONIP00000015382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]