SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015397 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015397
Domain Number 1 Region: 126-405
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-76
Family Nuclear receptor ligand-binding domain 0.0000000018
Further Details:      
 
Domain Number 2 Region: 73-152
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.03e-27
Family Nuclear receptor 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015397   Gene: ENSONIG00000012223   Transcript: ENSONIT00000015410
Sequence length 487
Comment pep:known_by_projection scaffold:Orenil1.0:GL831196.1:1635043:1655802:1 gene:ENSONIG00000012223 transcript:ENSONIT00000015410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDCMEALGMGPRQLYDVTSRGACMLRKANPFFAGLDPFAWTSTASVQSVETQSNSSEEM
VPSSPSPPPPPRVYKPCFVCQDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCQ
INKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKDVKEEVVLPESYELSGELEELVNK
VSKAHQETFPSLCQLGKYTTNSSSDHRVQLDLGLWDKFSELSTKCIIKIVEFAKRLPGFT
SLTIADQITLLKSACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVF
AFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPQKVDKLQEPLLEALKIYARRRRPNK
PHMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEAFDDQTESNESP
PPPPPPPPPPAPPALVLKQEAEDEDDSWATENGSEPSPEEEDEDDDDDVGDEDRDRGSDS
DGEPWVF
Download sequence
Identical sequences I3K2Q2
ENSONIP00000015397 ENSONIP00000015397 XP_012776648.1.88231 XP_013128600.1.78416 XP_013766170.1.53837 XP_014194612.1.24487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]