SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015758 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015758
Domain Number 1 Region: 112-126,281-519
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-66
Family Nuclear receptor ligand-binding domain 0.00000000504
Further Details:      
 
Domain Number 2 Region: 44-127
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.27e-30
Family Nuclear receptor 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015758   Gene: ENSONIG00000012517   Transcript: ENSONIT00000015773
Sequence length 521
Comment pep:known_by_projection scaffold:Orenil1.0:GL831204.1:1190307:1261462:1 gene:ENSONIG00000012517 transcript:ENSONIT00000015773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPKFETESLGLSRSYGEQGHMPRNMQAPQLKMMDYSYDEDLDEMCPVCGDKVSGYHYGL
LTCESCKGFFKRTVQNNKRYTCIENQSCQIDKTQRKRCPYCRFQKCLTVGMKLEAVRADR
MRGGRNKFGPMYKRDRALKQQKKALIRANGLKIEAMSQVMQAVPTDLTISSAIQNIHSAA
SKGLPLSHHAGHHTSHHHHHHHHGTALPPTDYDRSPFVTSPVSMAMPPHAGSLQGYQAAY
GHFQGTRTIKSEYPDPYTSSPESIMGYAYVDAYQSGSPPSFPHLIVELLKCEPDEPQVQA
KILAYLQQEQASRGKHEKLNTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQN
CWSELLILDHVFRQVVHAKEGSILLVTGQQVDYAVIASQAGATLNNLLSHAQELVAKLRS
LQLDQREFVCLKFLVLFSLDVKNLENFHLVESVQEQVNAALLDYVMCNYPQQTDKFGQLL
LRLPEIRAISLQAEEYLYYKHLNGDVPCNNLLIEMLHAKRA
Download sequence
Identical sequences I3K3R3
XP_003449057.1.78416 ENSONIP00000015758 ENSONIP00000015758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]