SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015934 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015934
Domain Number 1 Region: 7-186
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.52e-16
Family G proteins 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015934   Gene: ENSONIG00000012661   Transcript: ENSONIT00000015949
Sequence length 211
Comment pep:known_by_projection scaffold:Orenil1.0:GL831141.1:1869246:1871306:1 gene:ENSONIG00000012661 transcript:ENSONIT00000015949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSAKHSRERENIFNIILLGNSGTGKSASGNTLLNAGKHQRSSHQCFASYPSSTPVTTRC
KGIVVEMFGTQVRVVDTPDFFYEDQPVEKVQLEECKKYCKRRQHVMLLVLQLGRFTDGER
GLLEKLEKNFGTIRNNTIVLFTHGEDLHCDVRKFIGERTHLRRIVQACGNRYHVFKNTSK
DSGQVKALFKRFEDMFPNFNIKQSSAMFCCG
Download sequence
Identical sequences I3K489
XP_019217610.1.78416 ENSONIP00000015934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]