SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016176 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016176
Domain Number 1 Region: 518-762
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-60
Family Nuclear receptor ligand-binding domain 0.0000000135
Further Details:      
 
Domain Number 2 Region: 404-482
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-25
Family Nuclear receptor 0.0000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016176   Gene: ENSONIG00000012854   Transcript: ENSONIT00000016191
Sequence length 763
Comment pep:known scaffold:Orenil1.0:GL831331.1:1044687:1091668:-1 gene:ENSONIG00000012854 transcript:ENSONIT00000016191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQTTRELFCAKIWPEDRKSYTGDVVSAASMAQKTEESRVYFTKTPAGSSAASLAESENA
NLYGHIIPLACDMEKRCCQTAAAPQEELSAECRVGDSRSFSACATISETARELCKAVSVS
LGLAMESGDTSETHVSLPQCAANDQMSAEYLFGVEAVPANCPGAPASLSEYRCPERDERP
PHDHKQQVKMLKSSEPAAAFHHLSSTATSVNAQNFTLCEADDITPKEIDHLDIACAASCP
YAPAAPEPLAQFGPAAAQRPCRAYNPVEEAGDVGDAGENRSVGFQAERYGVKVKSEGSAS
AGALWVSRPNYSFGDKYNSQFWGSRQCMNLQSSGANSAFICNPYDGTVMRREQWYPGGML
RTPYPNSNYMKGEVGEWLDVTYNDTRFESSREHMFPMEFFFPPQRTCLICSDEASGCHYG
ALTCGSCKVFFKRAAEGKQKYLCASKNDCTIDKLRRKNCPSCRLKKCFEAGMTLGARKLK
KIGQQKSPEEDHGAQDPVEVIPNVSPKTGVQLNSHLVFLNILESIEPEVVNAGHDCGQPD
SADTLLTSLNELGERQLVKVVKWAKGLPGFRNLHVDDQMTIIQQSWMGVMVFALGWRSYK
NASGRILYFAPDLVFNEHRMHVSTMYEHCIRMRHLSQEFEMLQITQEEFHCMKALLLFSI
IPVEGLKSQKYFDELRLTYINELDRLINFQTTTNTSQRFYQLTRLMDSLQMTVKKLHQFT
FDLFVQAQSLHTKVSFPEMIGEIISVHVPKILTGLAKPILFHK
Download sequence
Identical sequences I3K4Y1
ENSONIP00000016176 ENSONIP00000016176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]