SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016308 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016308
Domain Number 1 Region: 3-173
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.46e-55
Family G proteins 0.0000000373
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016308   Gene: ENSONIG00000012965   Transcript: ENSONIT00000016323
Sequence length 191
Comment pep:known_by_projection scaffold:Orenil1.0:GL831225.1:1212241:1218840:-1 gene:ENSONIG00000012965 transcript:ENSONIT00000016323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSYENVKEKWVPEISHHCPSTPFLLVGTQVDLR
EDSNTVEKLAKNKQRPLLPESGEKLARELKAVKYVECSALTQRGLKNVFDEAILAALEPP
ETKTKKRCALL
Download sequence
Identical sequences I3K5B3
ENSONIP00000016308 XP_003450629.1.78416 ENSONIP00000016308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]