SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016446 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016446
Domain Number 1 Region: 182-453
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.33e-83
Family Nuclear receptor ligand-binding domain 0.00000000155
Further Details:      
 
Domain Number 2 Region: 129-211
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.04e-31
Family Nuclear receptor 0.00000928
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016446   Gene: ENSONIG00000013076   Transcript: ENSONIT00000016461
Sequence length 459
Comment pep:known_by_projection scaffold:Orenil1.0:GL831141.1:6274909:6316027:-1 gene:ENSONIG00000013076 transcript:ENSONIT00000016461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCVKHYTHRTDSSGQVTSSPLGSPTSHRGMHPSLLSPTSMGPSGPLHSPISTLSSPMNGL
ASPFSVISSPMGPHSMNSPGMGYGPSVSPQLNSPMNSVSSTEDIKPPLGLNGVMKVPAQP
SSTALSLTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCVIDKRQ
RNRCQYCRYQKCLAMGMKREAVQEERQRAKDKNENEVESTSCANEDMPVEKILEAEEAVE
PKTETYIETNLGVPSNSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRA
GWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMD
KTELGCLRAIVLFNPDSKGLSNPGEVEALREKVYASLEAYCKQKYPEQPGRFAKLLLRLP
ALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
Download sequence
Identical sequences I3K5Q1
ENSONIP00000016446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]