SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016633 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016633
Domain Number 1 Region: 2-85,116-180
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000392
Family Extended AAA-ATPase domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016633   Gene: ENSONIG00000013227   Transcript: ENSONIT00000016648
Sequence length 181
Comment pep:novel scaffold:Orenil1.0:AERX01077724.1:21:986:1 gene:ENSONIG00000013227 transcript:ENSONIT00000016648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHGPPGAGKSSFINSVDSTLRGKIATRALADATSGDSFTIAYKTFKIQKGNPETFYPFV
FTDTMGLERGTERGIHVEDIKLAISGHVKEGYTFKPTALLRESDPNYNSSPTLDDKVHIL
VVVIPADTVSIISDETWRKMKDVRLHARDKGIPQIAVITKIDEACPEVKKDIKNTYRSKH
L
Download sequence
Identical sequences I3K688
ENSONIP00000016633 ENSONIP00000016633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]