SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016788 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016788
Domain Number 1 Region: 313-550
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.26e-68
Family Nuclear receptor ligand-binding domain 0.0000000369
Further Details:      
 
Domain Number 2 Region: 184-266
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.89e-28
Family Nuclear receptor 0.0000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016788   Gene: ENSONIG00000013354   Transcript: ENSONIT00000016803
Sequence length 632
Comment pep:known scaffold:Orenil1.0:GL831215.1:796123:803939:-1 gene:ENSONIG00000013354 transcript:ENSONIT00000016803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRQSPAQSRQPCGPVLRPRDSPASSELEPHSPTRVSPSLRSPLNDMYPEESRGSGGVA
TVDFLEGTYDYAAPTPAPTPLYSHSTTGCYSAPLDAHGPLSDGSLQSLGSGPTSPLVFVP
SSPRLSPFMHPPSHHYLETTSTPVYRSSHQPVPREDQCGTRDEAYSVGELGAGAGGFEMT
KDTRFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQA
CRLRKCYEVGMMKGGMRKDRGRVLRREKRRACDRDKPAKDLPHTRASPQDGRKRAMSSSS
TSGGGGRSSLNNMPPDQVLLLLQGAEPPILSSRQKMSRPYTEVTIMTLLTSMADKELVHM
ITWAKKLPGFLQLSLHDQVLLLESSWLEVLMIGLIWRSIQCPGKLIFAQDLILDRNEGTC
VEGMAEIFDMLLATASRFRVLKLKPEEFVCLKAIILLNSGAFSFCTGTMEPLHDSAAVQH
MLDTITDALIFHISHLGCSAQQQSRRQAQLLLLLSHIRHMSNKGMEHLYSMKCKNKVPLY
DLLLEMLDAHRIHRPVKPFQSWSQGDRDSPTASSTSSSGGGGGDDEGASSAGSSSGPQGS
HESPRRENLSRAPTGPGVLQYRGSHSDCTRIP
Download sequence
Identical sequences I3K6P3
ENSONIP00000016788 ENSONIP00000016788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]