SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018019 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018019
Domain Number 1 Region: 249-552
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.77e-72
Family Nuclear receptor ligand-binding domain 0.0000000545
Further Details:      
 
Domain Number 2 Region: 148-232
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-27
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018019   Gene: ENSONIG00000014331   Transcript: ENSONIT00000018034
Sequence length 556
Comment pep:known_by_projection scaffold:Orenil1.0:GL831288.1:329577:369145:-1 gene:ENSONIG00000014331 transcript:ENSONIT00000018034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTPGRDFTHQTDHSFSVDMVDTQQLLAWPVGFSLNTADLPELEDSSHSLEMKHLSTFDY
ASISSSSIPSSLSPPLVSSIPSAGVAYDLSPPQSEEHLTNMDYTNMHSYRTQPDMFNSIK
LEPESPPQYSDSPVLSKLPDDTSAAALNIECRVCGDKASGFHYGVHACEGCKGFFRRTIR
LKLVYDHCDLHCRIHKKSRNKCQYCRFQKCLNVGMSHNAIRFGRMPQAEKEKLLAEFSSD
MEHMHPEAADLRALARHLYEAYLKYFPLTKAKARAILSGKTGDNVPFVIHDMKSLMEGEQ
FINCKQIPVPEHHQQQQHQTSTLPPVHGGYTETHPMSESEVMRMTGFGGHGEADAVELRF
FQSCQSRSAEAVREVTEFAKSIPGFVDLDLNDQVTLLKYGVIEVLIIMMSPLMNKDGTLI
SYGQIFMTREFLKSLRKPFCQMMEPKFEFSVKFNTLELDDSDMALFLAVIILSGDRPGLL
NVKPIEQLQETVLHSLELQLKLNHPDSLQLFAKLLQKMTDLRQIVTDHVHLIQLLKKTEI
DMCLHPLLQEIMKDLY
Download sequence
Identical sequences I3KA74
ENSONIP00000018019 ENSONIP00000018019 XP_005459073.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]